PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023278m
Common NameCARUB_v10023273mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 425aa    MW: 46531.4 Da    PI: 9.7192
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023278mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.7e-32160216360
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkversa +++v ei+Y+geHnh+k
  Carubv10023278m 160 DGYNWRKYGQKQVKGSECPRSYYKCTHPKCPVKKKVERSA-EGQVSEIVYQGEHNHSK 216
                      9***************************************.***************85 PP

2WRKY1031.6e-32347404259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dg++WrKYGqK+v g+ +prsYYrCtsa+C+++k+ver+++dp+++++tYeg+Hnh+
  Carubv10023278m 347 EDGFRWRKYGQKVVGGNAYPRSYYRCTSANCRARKHVERASDDPRAFITTYEGKHNHH 404
                      8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-28156217IPR003657WRKY domain
SMARTSM007743.9E-34158216IPR003657WRKY domain
SuperFamilySSF1182901.28E-24159217IPR003657WRKY domain
PfamPF031064.5E-25160214IPR003657WRKY domain
PROSITE profilePS5081122.905160217IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.6E-32336404IPR003657WRKY domain
PROSITE profilePS5081131.766341406IPR003657WRKY domain
SuperFamilySSF1182903.66E-27342404IPR003657WRKY domain
SMARTSM007743.9E-38346405IPR003657WRKY domain
PfamPF031066.8E-26347404IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MEGERVVIAK PVASRPSSSS SFRTFTELLT DTVTVSPQSN CHDIVDAAIR PKTLRFNQPV  60
AASVSCPRVE GNSNGNGKSC DDSDSRSYVV YKPKAKLVSK ATVSALANMG NRQQIWRQTE  120
AVGYGKSVSQ GTYRAGPNPI QKVPSFSESE SSIGDRSSVD GYNWRKYGQK QVKGSECPRS  180
YYKCTHPKCP VKKKVERSAE GQVSEIVYQG EHNHSKPSCP LPRRASSSTS SGFQKPPKGL  240
ASEGSMGQDH NNNLYRPLWS NQSNDSSKTR TEKMNEGCVI TPFEFAVPRS TNSNAGTSDS  300
GCRSSQCDEG SIGGELDDPN RTKRRKNEKQ SSEAGVSQGS VESDSLEDGF RWRKYGQKVV  360
GGNAYPRSYY RCTSANCRAR KHVERASDDP RAFITTYEGK HNHHLILNPP ASSTLPFNSQ  420
QLSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-28160405378Probable WRKY transcription factor 4
2lex_A2e-28160405378Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2896070.0AB289607.1 Arabidopsis thaliana TTG2 mRNA for WRKY transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294276.10.0hypothetical protein CARUB_v10023273mg
SwissprotQ9ZUU00.0WRK44_ARATH; WRKY transcription factor 44
TrEMBLR0HCI20.0R0HCI2_9BRAS; Uncharacterized protein
STRINGAT2G37260.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.10.0WRKY family protein